PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H02226.1.p
Common NameEUGRSUZ_H02226, LOC104457362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 340aa    MW: 36185 Da    PI: 9.0645
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H02226.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.4e-191156147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEde l  +v+++G+++W++I++ ++ gR++k+c++rw + 
  Eucgr.H02226.1.p 11 KGPWSPEEDEALRLLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 56
                      79******************************.***********985 PP

2Myb_DNA-binding55.41.4e-1765107347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eEd+++v+a++++G++ W+tIar +  gRt++ +k++w++ 
  Eucgr.H02226.1.p  65 AFTPEEDDIIVRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 107
                       79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.891661IPR017930Myb domain
SuperFamilySSF466892.58E-328104IPR009057Homeodomain-like
SMARTSM007171.6E-171059IPR001005SANT/Myb domain
PfamPF002495.7E-191156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-261264IPR009057Homeodomain-like
CDDcd001671.05E-161355No hitNo description
SMARTSM007171.6E-1462110IPR001005SANT/Myb domain
PROSITE profilePS5129421.16763112IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-2365111IPR009057Homeodomain-like
PfamPF002491.4E-1465107IPR001005SANT/Myb domain
CDDcd001679.14E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MASRKEVDRI KGPWSPEEDE ALRLLVQKHG PRNWSLISKS IPGRSGKSCR LRWCNQLSPQ  60
VEHRAFTPEE DDIIVRAHAR FGNKWATIAR LLSGRTDNAI KNHWNSTLKR KCSPPLSPLA  120
EEGNNRAFDA AAAAAAGYDG DLSPRERPAK RSASAGPCLS PGSPSGSGMS DSSVHFVYRP  180
VAKTGPVVPP TVEATAAAVS STEDPPTSLS LSLPGAADPC EVSTRVAAEP AQPATRPISL  240
LPMASDPAPT PACAPPQAVA LPEYPRYSGN NNSSSIFPYP PPSPRVGADF SPFKAEFMAV  300
MQEMIRAEVR NYMAGMCSQA AAADIRNAVV KRIGIGKIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-42101113104C-Myb DNA-Binding Domain
1msf_C2e-42101113104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H02226.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0594181e-98KF059418.1 Salvia miltiorrhiza MYB-related transcription factor (MYB64) mRNA, complete cds.
GenBankKF0595281e-98KF059528.1 Salvia miltiorrhiza MYB-related transcription factor (MYB64) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070607.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-83MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059B0620.0A0A059B062_EUCGR; Uncharacterized protein
STRINGVIT_07s0129g01050.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-75myb domain protein 73